Zelda Triforce The Hidden Triforce
 
  1. Notes: 2151 / 3 months ago  from thehyrulianprincess (originally from lakebedtemple-moved)
     
  2. Notes

    1. wiimin95 reblogged this from lakebedtemple-moved
    2. omfgthisblog reblogged this from legendofash
    3. whereisyourgodnoww reblogged this from m0nkey-sex
    4. pointandlaughatmaddy reblogged this from cyndaquart
    5. cyndaquart reblogged this from macarena-of-time
    6. macarena-of-time reblogged this from klinklang
    7. grizzly-of-time reblogged this from lakebedtemple-moved
    8. hyliafighting reblogged this from ev3rglades
    9. benenespliiit reblogged this from aglaweed
    10. aglaweed reblogged this from befuckingtrue
    11. befuckingtrue reblogged this from janitorscruffy
    12. theherooftimespast reblogged this from linkslullaby
    13. daynergarcia21 reblogged this from suckerfacetwist
    14. iwillkillabitch reblogged this from chocolatesmileyface
    15. chocolatesmileyface reblogged this from nickkphoenix
    16. noraegrets reblogged this from therealzelda
    17. theblerd reblogged this from watchoutbelow
    18. imm0rt4lity reblogged this from zoras-domain and added:
      gotta love this game
    19. foreversleepyme reblogged this from i-am-invincibl3 and added:
      Best game EVER! Legend of Zelda: Orcarina of Time
    20. i-am-invincibl3 reblogged this from era5e-me
    21. watchoutbelow reblogged this from tristerror
    22. logeeeywhatson reblogged this from the-down-to-my-fall
    23. the-down-to-my-fall reblogged this from just-let-it-end-223
    24. ill-just-keep-smiling reblogged this from just-let-it-end-223
    25. just-let-it-end-223 reblogged this from notaselfhelpb00k
    26. notaselfhelpb00k reblogged this from ravepandaz
    27. karenwonka reblogged this from productosalucinogenos
    28. productosalucinogenos reblogged this from prideordie
    29. prideordie reblogged this from holasoyuncocodrilo
    30. brandonjaaay reblogged this from ohhhangelo
    31. ohhhangelo reblogged this from calmparanoia
    32. janelizabeth reblogged this from snapethepimp
    33. kyraende reblogged this from theworldendsatonepiece
    34. sorcei reblogged this from theworldendsatonepiece
    35. abcdechan13 reblogged this from theworldendsatonepiece
    36. theworldendsatonepiece reblogged this from scarlet-rain
avatar_128
 
 
Facebook

About Me

Ask me anything

Why Video Games Are Not Anti-Social

Proof Sheik Is Female

My name is John, and I'm an 18 year old college freshman majoring in computer science. Welcome to my blog. Here, you can find plenty of Zelda fanboy spams, a few jokes, and maybe the occasional post written by yours truly. Feel free to find your inner Zelda fanboy here. I also run Advice for the Masses, which can be found here.

stats counter
HTML Hit Counter

 
 

Following

imstillgonnashinepornographyandmeathooksjericho-swainthe-absolute-best-gifsthegreatkeatontenshi-kakashilasciviouslinkgeek-arttristtristsupatunaatheistoverdosegirlswithglassesg33kgasmfallenlegacythe-absolute-funniest-postsdeliciousunicorntottlebudbelphegorsbitchsummonerjolansuperlinkthearaxiedopedekuprettycolorsequalistsfuckshituptheheroineoftimenovacrystallliscollegehumorthedailywhatpigtails-and-boobsrabididiotbronythelegendofyolohyruleneedsmedenzelgtfoponyconfessionslegendofsheikcutlerishask-the-twilight-princesslivinlavidaloki-dm1n3cr4ftkillsacredtwilightzeldaholymotherofrowlingkneehighstheyahooanswerssongofstorms724stapledfingerforyouistellifywithdisrespectcomesconsequenceklinklangko-uchuujinweebstoriesitstoplesstuesdaysomewherethearideefortyeahteamfortress2gifnationsixthdaychesh-shirejustagirlthatsmilesfuckinghardhatalienfuckerarylla1a1athehyrulianprincessinviolethoursbentleys-outpostsheikztristerrorcharalanahzardask-gangplankyoualwaysinspiremereikutohnomedic2askgpsnow-humanorangec3lebihylianherovaginal-erectionagithascastlefuckyeahlinkconfessionsofagamergirlnintendroiditzjustgaminstopplayingleagueibuprofitshadowlink-askmanlyteemoask-the9tailsfoxochutheprincesszeldaaikeepthepartyalivekatshivaatiask-vladimirfuckyourwolveseriklehnsherrfuckyesnintendod-avestridertheamericankidvictoriousvocabularyaskyorickdarksoulspygmytheboy-withoutafairyiraffiruseaicosuthe-water-mirrorsarlaccaskthenighthunterdeanpeltonsuperzeldaarcanoxthattomlinsonsassilgenponyrideshairlikesunshinepik-achu92mysterysongskibagoliquid-snakeforgornifreydumbgarchompask-heimerdingeraskpinktaricplaptorzeldaappreciationblogkyurempochamaramafuckyeahmariocateyeclovernoonebutrainbowdashespeoncha-cityyyhyruleanscholarask-malzaharwindfallislandask-ruggedgarenfuckinchrisfirebird463addictedtoleagueherooftwilighthumansrsuperiormorijandrostarkpixel-leaguehiddenzealotkaepgaebbawwkseetheforsakenfortressscraftytacgnolthegraingerzonelexilouisedyrusoestranhomundodekthenintendardtoxicspikesatheismfuckyeahmikkythesummonervideogamenostalgiaunwrappedcherriejosephgordon-levittmyzeldaslullabysnakelinksonicitsatravestyfuschiacrusader-kayrontetrasfuckyeahgamernerdsinlovethestrangestplacetobelolliconskyloftknightslaughterfishietripledrycapkissafishrachaelmakesshirtskasfnaturalbeauti3ssnowflakeswithplasticforkscomeandplayanotherdayhighhthereasamieswhat-is-this-i-dont-evenall-american-antichristsagesariadantedantephilphysvenomshockcaffeineandcarpaltunnelcoffeehomegroundmuaythaiislifestardustspeedwayunidentifiedspoonteeketchfemalebonertheplatinumpatriothiddinginthelimetreegodlesssciencep0cacuntasomgleagueoflegendsfeedercomicsreligiousragingsscaryspriteembraceyourshadowsbaka-le-grumpyxguppyprogrammedreactionthewingsoffurykisaraforeverasktheberserkerfuckyeahslendermancaptainkatikikikabukiivegotthetriforcedrunkrachelgummithuludianeisabirdaskriven-theexilebro-botsimprovingnerdinessnewmexicosongf0rsakenf0rtresssofapizzaskyecandreamsheikahthingsfuckyeahreactionsipolarberrymischiefandmerrimenttherealtayloraskchibikorrajust-ask-flutterguyjennamarbleszalielepicbroniestimetheappleofedenfuckyeahhyruleaskbmmpunchingvriskastaco1128666noellemnopmornanogetenemyasklulu-and-pixaskthechronokeepervaycuntthiswuwuuinsanelygamingbadcgijoshpancakesteinthesinisterbladetastefullyoffensivethederpydragondekusticksschwarzeniggerkillersgrinonshebronyfuckyeahtf2kokirishopkeepervulpixoxowwatertemplenight-owletask-the-mighty-thorthefuuuucomicsskiesofarcadiaaskthedeathsingergunnardemaciaaskthemightofdemaciajusta-littledarklink-sirderpicusamimis-understandingthe-fuhrmangamesgirlthatsonfireronyoartaskpiratedashask-slender-manasktalonandrealovesyouuyoureanerdasksonwukongfuckyeahocarinaoftimenotnotjohn4357milesisnothingnepetsvolloveasknocturnebesosdenutellanerdygirllovenonplussedbyreligionmentallywetoddedadventuretimewefellinloveonlineshoutacrossthelandaskashyguyquote-unquote-gamer-girlsask-themavenilove-faberryjessieandrewsfuckyeahnightmaresbetweenbrightnessshortformblognecro-hazzymancermulticolouredmirroremilylikesalienstheyuniversityoftomandreynolds
 

Tumblr